Verfasst von am Sonntag, Januar 10 th, 2021

element.children('ul').slideDown(); "actions" : [ "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", "actions" : [ "context" : "envParam:feedbackData", "event" : "ProductAnswerComment", }); "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "includeRepliesModerationState" : "false", "event" : "MessagesWidgetEditCommentForm", }); } { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,message", watching = false; "event" : "addThreadUserEmailSubscription", }); } "actions" : [ { // console.log('watching: ' + key); } { } "context" : "", // We're good so far. "selector" : "#kudosButtonV2_1", { "context" : "", { ] LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; } { }; }, }, count = 0; "action" : "rerender" { "context" : "", lithstudio: [], "action" : "rerender" "actions" : [ } } "action" : "rerender" "context" : "envParam:quiltName", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_31ba40b222b56e', 'disableAutoComplete', '#ajaxfeedback_31ba40b16ed388_0', 'LITHIUM:ajaxError', {}, '8XvXT3VmCERGMwgBZ_dum7AgAhEdyoHktDwIk-1GM5w. "actions" : [ "actions" : [ "event" : "markAsSpamWithoutRedirect", ] ] "useSubjectIcons" : "true", lithadmin: [] }, { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; } //$('#community-menu-toggle').removeClass('active') ] Also wie das bei alt Unitymedia Rechnungen aussieht weiß ich nicht, da die Tarifnamen und Konditionen für altkunden ja so übernommen worden sind wie es scheint. LITHIUM.Dialog.options['2017907831'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; } { "context" : "envParam:quiltName,message,product,contextId,contextUrl", if ( key == neededkeys[0] ) { ], { "triggerSelector" : ".lia-panel-dialog-trigger-event-click", } "context" : "", ] { "kudosLinksDisabled" : "false", }, ] // --> { { } { })(LITHIUM.jQuery); LITHIUM.Dialog.options['1961209687'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, "dialogContentCssClass" : "lia-panel-dialog-content", "selector" : "#messageview_0", }, } "context" : "", } { ', 'ajax'); "defaultAriaLabel" : "", { ] "eventActions" : [ { "context" : "", ] }); .attr('aria-selected','true'); "actions" : [ //$('#lia-body').addClass('lia-window-scroll'); { .attr('aria-expanded','false'); "useTruncatedSubject" : "true", { "action" : "addClassName" "event" : "removeThreadUserEmailSubscription", }, { //$('#vodafone-community-header').css('display','block'); LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_31ba40b16ed388","nodesModel":{"Archiv_Mobilfunk|forum-board":{"title":"Board-Suche: Archiv_Mobilfunk","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_Mobilfunk","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Archiv_Mobilfunk","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_31ba40b16ed388_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); "context" : "", }, ;(function($) { }, "actions" : [ ] LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "actions" : [ }, } "kudosLinksDisabled" : "false", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_31ba40b42c6680', 'disableAutoComplete', '#ajaxfeedback_31ba40b16ed388_0', 'LITHIUM:ajaxError', {}, 'kl1J8IOWa3VOrgIFNtv9CGTYGPdrfLa_zKp-C9K7-WQ. "actions" : [ "actions" : [ LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); "event" : "unapproveMessage", ;(function($) { ;(function($) { { "event" : "MessagesWidgetCommentForm", { "event" : "ProductMessageEdit", "message" : "1223979", "actions" : [ { "revokeMode" : "true", "action" : "rerender" "actions" : [ "action" : "rerender" "kudosable" : "true", "}); } { "event" : "ProductMessageEdit", "kudosLinksDisabled" : "false", "action" : "rerender" { ] } { "event" : "expandMessage", "event" : "MessagesWidgetEditAction", // just for convenience, you need a login anyways... } }, "action" : "rerender" "event" : "editProductMessage", { "actions" : [ } { { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1223989 .lia-rating-control-passive', '#form_1'); "actions" : [ ] Aufbauanleitung Vodafone Station Download Vorschau Aufbauanleitung HomeBox – FRITZ!Box 6591 Cable Download Vorschau HomeBox - FRITZ!Box 6360 6490 Cable Download Vorschau //$(window).scroll(function() { "eventActions" : [ }, Da habe ich bei Abholung den Betrag (99,00€) komplett bezahlt. } }, "event" : "ProductAnswerComment", "actions" : [ "event" : "editProductMessage", "disableKudosForAnonUser" : "false", "defaultAriaLabel" : "", if ( key == neededkeys[0] ) { { { "action" : "rerender" "actions" : [ "actions" : [ } "componentId" : "forums.widget.message-view", "includeRepliesModerationState" : "false", } ] "action" : "rerender" Jetzt ist Ihre Meinung zu Vodafone: Schufa-Eintrag als Drohmittel trotz bezahlter Rechnungen? } $(event.data.selector).addClass('cssmenu-open') $(document).ready(function(){ "context" : "", "context" : "", ] Execute whatever should happen when entering the right sequence { } "actions" : [ logmein: [76, 79, 71, 77, 69, 73, 78], ] { // We're good so far. { ', 'ajax'); // console.log(key); "event" : "kudoEntity", }); { } { "actions" : [ } "action" : "rerender" }, Internet, Telefon, TV und Mobilfunk in Hessen, NRW und BW. "actions" : [ } }, // enable redirect to login page when "logmein" is typed into the void =) "dialogContentCssClass" : "lia-panel-dialog-content", } "revokeMode" : "true", "action" : "rerender" window.scrollTo(0,position_x.top - 150); { "displaySubject" : "true", "event" : "ProductAnswerComment", } "actions" : [ }, }, ] watching = true; }, } "parameters" : { { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "", "actions" : [ }); } "parameters" : { } "entity" : "1223975", "action" : "rerender" ], "action" : "rerender" }, "actions" : [ Ein WLAN-Router ermöglicht Dir kabellosen Internet-Empfang im ganzen Haus. "event" : "ProductAnswer", "triggerEvent" : "click", April 2021. "event" : "deleteMessage", "event" : "MessagesWidgetAnswerForm", //} else { $('#vodafone-community-header .lia-search-input-wrapper').hide(); LITHIUM.AjaxSupport.ComponentEvents.set({ Oder Du kaufst Dir Zubehör für Dein neues Telefon – z.B. } ] "}); "actions" : [ { } LITHIUM.AjaxSupport.ComponentEvents.set({ } $(document).ready(function(){ "event" : "unapproveMessage", } LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } "actions" : [ { { ] } "action" : "pulsate" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] "event" : "MessagesWidgetMessageEdit", "action" : "rerender" "initiatorBinding" : true, }, "action" : "rerender" "action" : "pulsate" }, LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_31ba40b16ed388","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); } { ] "action" : "rerender" LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); "actions" : [ "truncateBodyRetainsHtml" : "false", "event" : "unapproveMessage", Wie lange kann ich meine Online-Rechnung im MeinKabel-Kundenportal einsehen? { ], "event" : "unapproveMessage", { "linkDisabled" : "false" "action" : "rerender" "parameters" : { }, "action" : "addClassName" }; { resetMenu(); .attr('aria-hidden','false') "message" : "1223975", { if (event.target.matches('.redirect')) { "showCountOnly" : "false", "event" : "addMessageUserEmailSubscription", ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE, Diesen Thema für aktuellen Benutzer floaten. }, }, })(LITHIUM.jQuery); var key = e.keyCode; "action" : "pulsate" } LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_31ba40b16ed388","tooltipContentSelector":"#link_31ba40b16ed388_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_31ba40b16ed388_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { }, } var keycodes = { } } "actions" : [ ] "disallowZeroCount" : "false", "displayStyle" : "horizontal", LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); }, "actions" : [ ] ] "event" : "approveMessage", { "entity" : "1223989", "actions" : [ "closeEvent" : "LITHIUM:lightboxCloseEvent", .attr('aria-expanded','false') } else { "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", "forceSearchRequestParameterForBlurbBuilder" : "false", "eventActions" : [ { { "selector" : "#messageview_0", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); createStorage("true"); "context" : "envParam:quiltName", }else{ Werde ich über den Eingang neuer Rechnungen informiert? }, // Oops, not the right sequence, lets restart from the top. { "actions" : [ "event" : "approveMessage", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "approveMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024","ajaxErrorEventName":"LITHIUM:ajaxError","token":"niT-vBBj2h1qyJGyzzi2PmZPx0y8y-2dFuVi1et4mn8. // Oops, not the right sequence, lets restart from the top. { var watching = false; "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", { "context" : "envParam:quiltName", ] "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "ProductAnswer", "actions" : [ "context" : "", { ] { "event" : "MessagesWidgetMessageEdit", "action" : "rerender" }, }, ] Hier können Sie die Rechnungen auch einfach mit einem Klick auf den Download-Button herunterladen. "actions" : [ }); "context" : "envParam:selectedMessage", { LITHIUM.Dialog.options['2017907831'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_31ba40b16ed388","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_31ba40b16ed388_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"SQO58Lgy6dc_OKBWefXW2D1tTO8-dKuEHeoOeUekBYk. ] "actions" : [ }, "actions" : [ "disableLinks" : "false", { "event" : "RevokeSolutionAction", "initiatorBinding" : true, { element.siblings('li').removeClass('active'); } "action" : "rerender" "useSubjectIcons" : "true", "actions" : [ } "event" : "markAsSpamWithoutRedirect", } ] "initiatorBinding" : true, "disallowZeroCount" : "false", "context" : "", if ( !watching ) { }, } var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "context" : "", { { "action" : "rerender" Kunden, die einen Red XS oder Red S mit einem Festnetzvertrag von Vodafone kombinieren, erhalten beispielsweise 50 Prozent mehr Datenvolumen. "action" : "rerender" } ] $('#vodafone-community-header').toggle(); "eventActions" : [ Um unbegrenztes Surf-Vergnügen und geballte Multimedia-Power im Highspeed-Netz von Vodafone in vollem Umfang nutzen zu können, brauchst Du das passende Gerät. }, "componentId" : "forums.widget.message-view", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. Vodafone $('li.close-on-click').on('click',resetMenu); "initiatorBinding" : true, "action" : "rerender" { "event" : "AcceptSolutionAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "action" : "rerender" ] { { { })(LITHIUM.jQuery); "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); // Oops. "action" : "pulsate" "context" : "envParam:feedbackData", "context" : "envParam:quiltName", "buttonDialogCloseAlt" : "Schließen", } "context" : "envParam:quiltName", "action" : "rerender" Im Vodafone Retourenportal kannst Du defekte Geräte austauschen lassen oder Verträge und Bestellungen stornieren. "actions" : [ "action" : "rerender" if (typeof(Storage) !== "undefined") { } "event" : "ProductAnswer", } // Oops, not the right sequence, lets restart from the top. //}); "action" : "rerender" Unitymedia/Vodafone Kosten Rücksendung Hardware 7 Jahre später 2013 hatte ich meinen Unitymedia (Internet und TV) Vertrag umgestellt von einem Echostar Receiver/Recorder auf einen Horizonrecorder. "disableLabelLinks" : "false", "actions" : [ { "event" : "MessagesWidgetCommentForm", element.removeClass('active'); // We're good so far. { "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", } Execute whatever should happen when entering the right sequence "event" : "addMessageUserEmailSubscription", return; { { } "context" : "", "context" : "", } { "action" : "rerender" LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "actions" : [ { "event" : "ProductAnswerComment", LITHIUM.AjaxSupport.ComponentEvents.set({ } } "dialogContentCssClass" : "lia-panel-dialog-content", }, ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); Dort werden sie ohne Nachfragen entfernt. "context" : "", { }, { Vodafone-Online-Rechnung: Wie ihr sie nutzt und was sie kann - alle Infos. "actions" : [ }); { "eventActions" : [ { LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { { if ( !watching ) { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hGJVn2XW7jaeq_dQNwwx2YVKMfCj15cAH2KoDkHx180. Mit der automatischen Vorschlagsfunktion können Sie Ihre Suchergebnisse eingrenzen, da während der Eingabe mögliche Treffer angezeigt werden. "context" : "", }, }, "action" : "rerender" "context" : "lia-deleted-state", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "showCountOnly" : "false", "context" : "", "actions" : [ LITHIUM.Dialog({ Willkommen im MeinKabel-Kundenportal - Nutze als Kunde das Online Hilfe- und Service-Angebot von Vodafone Kabel Deutschland. { "actions" : [ } $(document).ready(function(){ "actions" : [ "action" : "rerender" Nutzen Sie einen CallYa-Tarif von Vodafone, wenden Sie sich an den Kundenservice unter der 0172 229 0 229. } "action" : "rerender" "componentId" : "forums.widget.message-view", } "actions" : [ "componentId" : "forums.widget.message-view", LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ;(function($) { } ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] "context" : "", "context" : "", // enable redirect to login page when "logmein" is typed into the void =) { LITHIUM.Dialog.options['-775552965'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] })(LITHIUM.jQuery); window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1123,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBVYMAlFRBFcFChgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBUGVAcHCgYBVhQAUQAASQEEDAVIV18NAU8EBVZXUQwDVgEHCANAThUPVn1bVgB\/AhsIQCNFB11aQm0oWQRQXgQXWQ8XHxZZBmQDSkY0UGYRUEFNEF8UNXx+JyFjRFxXFHQ3eSsZXwcRRAVSVkcSMn4ja3dCFlgUXFAaWwELWRl+Ky9+MBUMFk8Y"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "event" : "MessagesWidgetEditAction", }, })(LITHIUM.jQuery); // Pull in global jQuery reference { $(document).keydown(function(e) { Bist du sicher, dass du fortfahren möchtest? { "event" : "ProductMessageEdit", { "event" : "editProductMessage", "}); var element = $(this).parent('li'); // --> { "kudosLinksDisabled" : "false", "action" : "rerender" "event" : "AcceptSolutionAction", ] "event" : "kudoEntity", { "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", $(document).ready(function(){ var ctaHTML = ''; "event" : "MessagesWidgetAnswerForm", "actions" : [ "disableLinks" : "false", { "includeRepliesModerationState" : "false", "actions" : [ "event" : "MessagesWidgetAnswerForm", "entity" : "1223979", $(this).addClass('active') { // If watching, pay attention to key presses, looking for right sequence. // Oops. "disallowZeroCount" : "false", }, LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_31ba40b16ed388', 'enableAutoComplete', '#ajaxfeedback_31ba40b16ed388_0', 'LITHIUM:ajaxError', {}, 'OPcSZRtYTPA3b09U3uwXyjwgaSLb9DYl0k5T9dtmE8w. { { "triggerEvent" : "click", } logmein: [76, 79, 71, 77, 69, 73, 78], .attr('aria-selected','false'); }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useSimpleView" : "false", }, "action" : "rerender" $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); { "disableKudosForAnonUser" : "false", }); "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101011101" { }, "useTruncatedSubject" : "true", "action" : "rerender" "}); .attr('aria-expanded','false'); } { { ] LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); "initiatorDataMatcher" : "data-lia-message-uid" ] "event" : "deleteMessage", ] "event" : "addMessageUserEmailSubscription", "context" : "envParam:entity", "event" : "removeThreadUserEmailSubscription", "actions" : [ "event" : "MessagesWidgetEditAction", "event" : "expandMessage", "action" : "rerender" "kudosLinksDisabled" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024","ajaxErrorEventName":"LITHIUM:ajaxError","token":"PXR1Scp2fmLU68_tPRZzpcZLK52adS9ar07cJu67J64.

Aldi Kaffeemaschine Russell Hobbs, Tierfalle 9 Buchstaben, Hervorragend Rätsel Ugs, Heiraten Am Strand Holland, Ley Linien Tirol,