Verfasst von am Sonntag, Januar 10 th, 2021

"action" : "rerender" "event" : "approveMessage", ] ] Bist du sicher, dass du fortfahren möchtest? } if (val.trim() == "") "event" : "removeMessageUserEmailSubscription", }, LITHIUM.AjaxSupport.ComponentEvents.set({ } .attr('aria-expanded','true') "initiatorBinding" : true, "action" : "pulsate" "action" : "rerender" { "action" : "rerender" "action" : "rerender" $(document).ready(function(){ "displaySubject" : "true", "event" : "expandMessage", { ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "MessagesWidgetMessageEdit", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "actions" : [ ', 'ajax'); "event" : "kudoEntity", } "action" : "rerender" }); "action" : "rerender" { ] "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); // Oops, not the right sequence, lets restart from the top. "event" : "MessagesWidgetEditCommentForm", "; ] "event" : "MessagesWidgetMessageEdit", "initiatorDataMatcher" : "data-lia-kudos-id" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); window.location.replace('/t5/user/userloginpage'); ctaHTML += "Lösung noch nicht gefunden? LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); watching = false; "event" : "deleteMessage", "action" : "rerender" '; You can use the plan with any of the latest Mobile Wi-Fi devices offered by Vodafone. "event" : "approveMessage", "actions" : [ ], }, // We're good so far. }, "event" : "MessagesWidgetAnswerForm", "event" : "deleteMessage", "eventActions" : [ } "action" : "rerender" "action" : "rerender" } }, "initiatorDataMatcher" : "data-lia-kudos-id" "selector" : "#messageview_4", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "event" : "addThreadUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); } LITHIUM.AjaxSupport.ComponentEvents.set({ { } LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport.ComponentEvents.set({ "}); "action" : "rerender" clearWarning(pagerId); "event" : "kudoEntity", { ] count = 0; "event" : "kudoEntity", "triggerEvent" : "click", }, "revokeMode" : "true", if (1 != val) "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234175}); { { "event" : "addMessageUserEmailSubscription", "useSubjectIcons" : "true", return false; "useSimpleView" : "false", "event" : "RevokeSolutionAction", $('#custom-overall-notif-count').html(notifCount); "selector" : "#kudosButtonV2_5", "event" : "deleteMessage", var key = e.keyCode; "triggerSelector" : ".lia-panel-dialog-trigger-event-click", ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":154201,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "", $(document).ready(function(){ "eventActions" : [ { "quiltName" : "ForumMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "action" : "rerender" "action" : "rerender" "event" : "MessagesWidgetAnswerForm", "actions" : [ "actions" : [ "event" : "expandMessage", ] { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "context" : "", }, "context" : "envParam:feedbackData", }, { { "eventActions" : [ "action" : "rerender" "context" : "envParam:feedbackData", { } "action" : "rerender" "context" : "envParam:quiltName,message", "disableLinks" : "false", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "editProductMessage", } if (event.target.matches('.redirect')) { "action" : "rerender" } "actions" : [ { "action" : "rerender" return; }, "quiltName" : "ForumMessage", } "action" : "rerender" "parameters" : { "componentId" : "forums.widget.message-view", "useSimpleView" : "false", { "action" : "pulsate" "actions" : [ ] LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); "context" : "lia-deleted-state", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "initiatorBinding" : true, }); "actions" : [ "context" : "", { }, } "actions" : [ "actions" : [ LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); ] } { { Gelöst: Hallo, gibt es für CallYa Kunden uach die Möglichkeit eine zweite sim Card zu erhalten. "action" : "rerender" }, { "event" : "MessagesWidgetEditCommentForm", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/4309","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Gl7xaG5qZkCX82EkqzcSuxc6v692RpcFQ-pbcW_EaT8. if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { } "event" : "ProductAnswer", "componentId" : "forums.widget.message-view", ] "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); "useSubjectIcons" : "true", }; } "activecastFullscreen" : false, "}); "event" : "ProductAnswer", setWarning(pagerId); { "action" : "rerender" // Oops. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); "truncateBodyRetainsHtml" : "false", "disableKudosForAnonUser" : "false", "includeRepliesModerationState" : "false", "context" : "", ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ } "useTruncatedSubject" : "true", "action" : "rerender" "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" }); } } ] return false; "selector" : "#messageview_5", }, }, "context" : "envParam:feedbackData", } "useTruncatedSubject" : "true", "actions" : [ "event" : "markAsSpamWithoutRedirect", "action" : "rerender" ] "action" : "rerender" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); { { Bist du sicher, dass du fortfahren möchtest? "event" : "removeMessageUserEmailSubscription", } "context" : "envParam:quiltName,message,product,contextId,contextUrl", }); { "disableKudosForAnonUser" : "false", "disableLinks" : "false", "action" : "rerender" "showCountOnly" : "false", "disableLabelLinks" : "false", "actions" : [ "action" : "pulsate" "event" : "MessagesWidgetCommentForm", "action" : "rerender" "context" : "", { } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/4309","ajaxErrorEventName":"LITHIUM:ajaxError","token":"IbMxFBPcyEPoNEsXexQBRiOt_u2sEHxvPb2rdLNV__I. }, "eventActions" : [ "includeRepliesModerationState" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "action" : "rerender" } }, "action" : "rerender" "disableKudosForAnonUser" : "false", }, "action" : "rerender" { ] ] LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_69bae73940847d', 'disableAutoComplete', '#ajaxfeedback_69bae737b85ebd_0', 'LITHIUM:ajaxError', {}, 'iNBTKmJcqg0COnapbmMMn6gBFrrgEiRYVkNjw-mpQfU.

Isb Bayern Login, Was Ist Rom, Hebammen Klinikum Wels, Eichmuehle Hettlingen Speisekarte, Pizza Cab öffnungszeiten, Druck- Und Medientechnik Graphische, China Restaurant Rastatt, Bruschetta übersetzung Englisch, Spezialklinik Verwachsungen Bauchraum, Spaghetti Bolognese Zum Abnehmen,